SCGN Polyclonal antibody, PBS Only

• 

  WB analysis of mouse pancreas using 14919-1-AP (same clone as 14919-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 14919-1-AP (same clone as 14919-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 14919-1-AP (same clone as 14919-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 14919-1-AP (same clone as 14919-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse stomach using 14919-1-AP (same clone as 14919-1-PBS)

  mouse stomach tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 14919-1-AP (same clone as 14919-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 14919-1-AP (same clone as 14919-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 14919-1-AP (same clone as 14919-1-PBS)

  IP result of anti-SCGN (IP:14919-1-AP, 4ug; Detection:14919-1-AP 1:500) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 14919-1-PBS in a different storage buffer formulation.

SCGN Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 14919-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

14919-1-PBS targets SCGN in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6736

  Product name: Recombinant human SCGN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-276 aa of BC000336

  Sequence: MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

• Full Name: secretagogin, EF-hand calcium binding protein
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000336
• Gene Symbol: SCGN
• Gene ID (NCBI): 10590
• RRID: AB_2183555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76038
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.