SCGN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SCGN Polyclonal antibody (14919-1-AP)

SCGN Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14919-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

SECRET, Secretagogin, SEGN, setagin

• 

  WB analysis of mouse pancreas using 14919-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 14919-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 14919-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse stomach using 14919-1-AP

  mouse stomach tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse colon using 14919-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 14919-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 14919-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 14919-1-AP (SCGN Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 14919-1-AP

  IP result of anti-SCGN (IP:14919-1-AP, 4ug; Detection:14919-1-AP 1:500) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 14919-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14919-1-AP (SCGN antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SCGN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, fetal human brain tissue, mouse colon tissue, mouse liver tissue, mouse stomach tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14919-1-AP targets SCGN in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6736

  Product name: Recombinant human SCGN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-276 aa of BC000336

  Sequence: MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

• Full Name: secretagogin, EF-hand calcium binding protein
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC000336
• Gene Symbol: SCGN
• Gene ID (NCBI): 10590
• RRID: AB_2183555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76038
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SCGN Polyclonal antibody (Cat# 14919-1-AP) has 1 citation, published in Molecular & Cellular Proteomics (2025). The study investigated secretagogin downregulation impairing nerve cell migration in Hirschsprung disease via inhibition of the LEF-1/NCAM1 axis, placing it in the fields of developmental neuroscience and gastrointestinal motility disorders. The antibody was used for WB and IHC in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Mol Cell Proteomics; Secretagogin Downregulation Impairs Nerve Cell Migration in Hirschsprung Disease via Inhibition of the LEF-1/NCAM1 Axis.; Authors - Yun Zhou