SCN1A Polyclonal antibody, PBS Only

• 

  WB analysis of PC-12 using 28079-1-AP (same clone as 28079-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 28079-1-AP (SCN1A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28079-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28079-1-AP (same clone as 28079-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28079-1-AP (SCN1A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28079-1-PBS in a different storage buffer formulation.

SCN1A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28079-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

sodium channel, Pan, FEB3, GEFSP2, HBSCI, NAC1

---

Product Information

28079-1-PBS targets SCN1A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25942

  Product name: Recombinant human SCN1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 456-522 aa of NM_001165963

  Sequence: MEAAQQAATATASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQK

• Full Name: sodium channel, voltage-gated, type I, alpha subunit
• Calculated Molecular Weight: 229 kDa
• Observed Molecular Weight: 229-240 kDa
• GenBank Accession Number: NM_001165963
• Gene Symbol: SCN1A
• Gene ID (NCBI): 6323
• RRID: AB_2881054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35498
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sodium channel protein type 1 subunit alpha (SCN1A) is a multi-pass membrane protein that is crucial for generating and transmitting electrical signals in neurons, thereby contributing to the sensory perception of mechanically-induced pain (PMID: 14672992). SCN1A also regulates neuronal excitability and is essential for normal brain function (PMID: 37139072; 20831750).