SCN3B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82959-1-RR (same clone as 82959-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82959-1-RR (SCN3B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82959-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82959-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 82959-1-RR against Human SCN3B were performed. The affinity constant is 0.429 nM.

SCN3B Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 82959-1-PBS

Clone No.230316F8

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat, mouse

Applications

WB, Indirect ELISA

Synonyms

Sodium channel subunit beta 3, Sodium channel regulatory subunit beta-3, SCNB3, KIAA1158, HSA243396

---

Product Information

82959-1-PBS targets SCN3B in WB, Indirect ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23201

  Product name: Recombinant human SCN3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-93 aa of BC126265

  Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ

• Full Name: sodium channel, voltage-gated, type III, beta
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC126265
• Gene Symbol: SCN3B
• Gene ID (NCBI): 55800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NY72
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The sodium voltage-gated channel beta subunit 3 (SCN3B) plays a crucial role in electrically excitable cells and conduction tissue in the heart. Some previous studies have established that genetic modification in sodium voltage-channel genes encoding for the cardiac β-subunits, such as SCN1B, SCN2B, SCN3B and SCN4B, can result in atrial fibrillation (AF). (PMID: 36362949)