Tested Applications
| Positive WB detected in | HEK-293 cells, rat brain tissue, mouse brain tissue, fetal human brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82959-1-RR targets SCN3B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag23201 Product name: Recombinant human SCN3B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-93 aa of BC126265 Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ Predict reactive species |
| Full Name | sodium channel, voltage-gated, type III, beta |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC126265 |
| Gene Symbol | SCN3B |
| Gene ID (NCBI) | 55800 |
| RRID | AB_3670703 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NY72 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The sodium voltage-gated channel beta subunit 3 (SCN3B) plays a crucial role in electrically excitable cells and conduction tissue in the heart. Some previous studies have established that genetic modification in sodium voltage-channel genes encoding for the cardiac β-subunits, such as SCN1B, SCN2B, SCN3B and SCN4B, can result in atrial fibrillation (AF). (PMID: 36362949)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SCN3B antibody 82959-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



