SCN4A Polyclonal antibody

• 

  IHC staining of mouse skeletal muscle using 28315-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28315-1-AP (SCN4A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 28315-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28315-1-AP (SCN4A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SCN4A Polyclonal Antibody for IHC, ELISA

Cat No. 28315-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

HYKPP, HYPP, Na(V)1.4, NAC1A, Nav1.4

---

Tested Applications

• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28315-1-AP targets SCN4A in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27536

  Product name: Recombinant human SCN4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 803-1026 aa of NM_000334

  Sequence: MSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFLLGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLADGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLYDGNSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRRACFK

• Full Name: sodium channel, voltage-gated, type IV, alpha subunit
• Calculated Molecular Weight: 208 kDa
• GenBank Accession Number: NM_000334
• Gene Symbol: SCN4A
• Gene ID (NCBI): 6329
• RRID: AB_2881109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35499
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sodium channel protein type 4 subunit alpha (SCN4A, also known as Nav1.4) is the pore-forming subunit of the primary sodium channel present in skeletal muscles (PMID: 16193245). Nav1.4 related channelopathies that affect skeletal muscle excitability are dominant diseases classified in two opposite groups as defined by the prevalent clinical symptoms: muscle stiffness and hypertonia (myotonia) episodes [non dystrophic myotonias (NDM)], and muscle weakness resulting in paralysis episodes (periodic paralyses; PP) (PMID: 20237798; 26285000).