SCN8A Polyclonal antibody

• 

  IHC staining of mouse brain using 28504-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28504-1-AP (SCN8A antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SCN8A Polyclonal Antibody for IHC, ELISA

Cat No. 28504-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IHC, ELISA

Synonyms

CerIII, MED, NaCh6, Nav1.6, PN4, SCN8A

---

Tested Applications

• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28504-1-AP targets SCN8A in IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26950

  Product name: Recombinant human SCN8A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1767-1907 aa of NM_001177984

  Sequence: MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR

• Full Name: sodium channel, voltage gated, type VIII, alpha subunit
• Calculated Molecular Weight: 225 kDa
• GenBank Accession Number: NM_001177984
• Gene Symbol: SCN8A
• Gene ID (NCBI): 6334
• RRID: AB_3086060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQD0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.