SCN8A Polyclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 28504-1-AP (same clone as 28504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28504-1-AP (SCN8A antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28504-1-PBS in a different storage buffer formulation.

SCN8A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28504-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

28504-1-PBS targets SCN8A in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26950

  Product name: Recombinant human SCN8A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1767-1907 aa of NM_001177984

  Sequence: MENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYCKLADFADALEHPLRVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPSKVSYEPITTTLRRKQEEVSAVVLQRAYR

• Full Name: sodium channel, voltage gated, type VIII, alpha subunit
• Calculated Molecular Weight: 225 kDa
• GenBank Accession Number: NM_001177984
• Gene Symbol: SCN8A
• Gene ID (NCBI): 6334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQD0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.