SCP2/SCPx Polyclonal antibody, PBS Only

• 

  WB analysis using 23006-1-AP (same clone as 23006-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23006-1-AP (SCP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 23006-1-AP (same clone as 23006-1-PBS)

  WB result of SCP2 antibody (23006-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SCP2 transfected HEK-293 cells. This data was developed using the same antibody clone with 23006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 23006-1-AP (same clone as 23006-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 23006-1-AP (SCP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 23006-1-AP (same clone as 23006-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 23006-1-AP (SCP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23006-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 23006-1-AP (same clone as 23006-1-PBS)

  IP result of anti-SCP2 (IP:23006-1-AP, 4ug; Detection:23006-1-AP 1:500) with HepG2 cells lysate 3600ug. This data was developed using the same antibody clone with 23006-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 23006-1-AP (same clone as 23006-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 23006-1-AP (SCP2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 23006-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 23006-1-AP (same clone as 23006-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human SCP2 (23006-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 23006-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SCP2/SCPx Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 23006-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

SCP2, Acetyl-CoA C-myristoyltransferase, EC:2.3.1.155, EC:2.3.1.16, EC:2.3.1.176

---

Product Information

23006-1-PBS targets SCP2/SCPx in WB, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19215

  Product name: Recombinant human SCP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 405-547 aa of BC005911

  Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

• Full Name: sterol carrier protein 2
• Calculated Molecular Weight: 547 aa, 59 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC005911
• Gene Symbol: SCP2
• Gene ID (NCBI): 6342
• RRID: AB_2879197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22307
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. 23006-1-AP antibody recognizes the 13-15 kDa SCP2 protein.