SCP2/SCPx Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SCP2/SCPx Polyclonal antibody (23006-1-AP)

• Featured Product
• KD/KO Validated

SCP2/SCPx Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 23006-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

SCP2, Acetyl-CoA C-myristoyltransferase, EC:2.3.1.155, EC:2.3.1.16, EC:2.3.1.176

• 

  WB analysis using 23006-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23006-1-AP (SCP2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 23006-1-AP

  WB result of SCP2 antibody (23006-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SCP2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 23006-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 23006-1-AP (SCP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 23006-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 23006-1-AP (SCP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 23006-1-AP

  IP result of anti-SCP2 (IP:23006-1-AP, 4ug; Detection:23006-1-AP 1:500) with HepG2 cells lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 23006-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 23006-1-AP (SCP2/SCPx antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 23006-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 23006-1-AP (SCP2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 23006-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human SCP2 (23006-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SCP2/SCPx in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HEK-293 cells, K-562 cells, NIH/3T3 cells, HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human stomach cancer tissue, human placenta tissue, rat stomach tissue, mouse lung tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23006-1-AP targets SCP2/SCPx in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19215

  Product name: Recombinant human SCP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 405-547 aa of BC005911

  Sequence: MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

• Full Name: sterol carrier protein 2
• Calculated Molecular Weight: 547 aa, 59 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC005911
• Gene Symbol: SCP2
• Gene ID (NCBI): 6342
• RRID: AB_2879197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22307
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. 23006-1-AP antibody recognizes the 13-15 kDa SCP2 protein.

Publications

What published studies show

The SCP2/SCPx Polyclonal antibody (Cat# 23006-1-AP) has 21 citations. These appear in journals including Nature Cell Biology, Nature Communications, Nature Chemical Biology, Advanced Science, Phytomedicine, Cell Death Discovery, Cell Metabolism, Journal of Biological Chemistry, PLoS One, iScience, Communications Biology, and others. Research fields span lipid metabolism and homeostasis, peroxisomal biology, ferroptosis, cholesterol trafficking, atherosclerosis, and various cancers (liver, cervical, breast), as well as cardiac injury and hepatic fibrosis. Applications include WB, IF, IHC, and IP.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Cell Biol; PEX39 facilitates the peroxisomal import of PTS2-containing proteins; Authors - Walter W Chen
human	IF	Nat Cell Biol; YAP maintains the dynamics of TDP-43 condensates and antagonizes TDP-43 pathological aggregates; Authors - Jiaqi Zhang
mouse	WB	Nat Commun; Systematic HOIP interactome profiling reveals critical roles of linear ubiquitination in tissue homeostasis; Authors - Yesheng Fu
human	WB	Nat Chem Biol; Membrane editing with proximity labeling reveals regulators of lipid homeostasis.; Authors - Reika Tei
human	WB,IHC,IF	Adv Sci (Weinh); Erucic Acid, Derived by Lactobacillus Crispatus, Induces Ferroptosis in Cervical Cancer Organoids Through the PPAR-δ Signaling Pathway.; Authors - Qianwei Zhen
human	WB,IF,CoIP	Adv Sci (Weinh); TrxR2 Lactylation Facilitates Mitochondrial Protection and Endothelial Ferroptosis Resistance in Diabetic Cardiomyopathy.; Authors - Su Li