SCRG1 Polyclonal antibody, PBS Only

• 

  IHC staining of human testis using 14038-1-AP (same clone as 14038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14038-1-AP (SCRG1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14038-1-AP (same clone as 14038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14038-1-AP (SCRG1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14038-1-AP (same clone as 14038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14038-1-AP (SCRG1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14038-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 14038-1-AP (same clone as 14038-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14038-1-AP (SCRG1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14038-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SCRG1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 14038-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

14038-1-PBS targets SCRG1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5104

  Product name: Recombinant human SCRG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC017583

  Sequence: MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHF

• Full Name: scrapie responsive protein 1
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC017583
• Gene Symbol: SCRG1
• Gene ID (NCBI): 11341
• RRID: AB_2878003
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75711
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.