Tested Applications
| Positive IHC detected in | mouse brain tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14038-1-AP targets SCRG1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5104 Product name: Recombinant human SCRG1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC017583 Sequence: MKLMVLVFTIGLTLLLGVQAMPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHF Predict reactive species |
| Full Name | scrapie responsive protein 1 |
| Calculated Molecular Weight | 11 kDa |
| GenBank Accession Number | BC017583 |
| Gene Symbol | SCRG1 |
| Gene ID (NCBI) | 11341 |
| RRID | AB_2878003 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75711 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SCRG1 antibody 14038-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Stem Cells Int Scrapie-Responsive Gene 1 Promotes Chondrogenic Differentiation of Umbilical Cord Mesenchymal Stem Cells via Wnt5a.
| ||
Nat Aging A distinct astrocyte subtype in the aging mouse brain characterized by impaired protein homeostasis | ||
Biomaterials Gradient intrafibrillar mineralized collagen scaffold promotes osteochondral regeneration by enhancing differentiation of SCRG1(+) progenitor cells. |







