SDF4 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse testis using 10517-1-AP (same clone as 10517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10517-1-AP (SDF4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 10517-1-AP (same clone as 10517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10517-1-AP (SDF4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 10517-1-AP (same clone as 10517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10517-1-AP (SDF4 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 10517-1-AP (same clone as 10517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10517-1-AP (SDF4 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 10517-1-AP (same clone as 10517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 10517-1-AP (SDF4 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10517-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 10517-1-AP (same clone as 10517-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 10517-1-AP (SDF4 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10517-1-PBS in a different storage buffer formulation.

SDF4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 10517-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

10517-1-PBS targets SDF4 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0806

  Product name: Recombinant human SDF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 155-362 aa of BC006211

  Sequence: GHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEETQEVLENLKDRWYQADSPPADLLLTEEEFLSFLHPEHSRGMLRFMVKEIVRDLDQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTAEELESYMDPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSKLVDYARSVHEEF

• Full Name: stromal cell derived factor 4
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: BC006211
• Gene Symbol: SDF4
• Gene ID (NCBI): 51150
• RRID: AB_2301345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRK5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.