SDHAF4 Polyclonal antibody

• 

  IP experiment of THP-1 using 30663-1-AP

  IP result of anti-SDHAF4 (IP:30663-1-AP, 4ug; Detection:30663-1-AP 1:1000) with THP-1 cells lysate 1800 ug.

• 

  IHC staining of human breast cancer using 30663-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 30663-1-AP (C6orf57 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 30663-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 30663-1-AP (C6orf57 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 30663-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using C6orf57 antibody (30663-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of U2OS using 30663-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using C6orf57 antibody (30663-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

SDHAF4 Polyclonal Antibody for IHC, IF/ICC, IP, ELISA

Cat No. 30663-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IP, ELISA

Synonyms

C6orf57, SDH assembly factor 4, Succinate dehydrogenase assembly factor 4, mitochondrial, Succinate Dehydrogenase Complex Assembly Factor 4, UPF0369 protein C6orf57

---

Tested Applications

• Positive IP detected in: THP-1 cells
• Positive IHC detected in: human cervical cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells, U2OS cells

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30663-1-AP targets SDHAF4 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33549

  Product name: Recombinant human C6orf57 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-108 aa of BC104649

  Sequence: ARSPLLCHSLRKTSSSQGGKSELVKQSLKKPKLPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF

• Full Name: chromosome 6 open reading frame 57
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC104649
• Gene Symbol: C6orf57
• Gene ID (NCBI): 135154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VUM1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SDHAF4 (Succinate Dehydrogenase Assembly Factor 4) is a key mitochondrial protein specifically responsible for assisting in the assembly and stability of mitochondrial complex II (Succinate Dehydrogenase, SDH). This complex plays a central role in cellular energy metabolism by participating simultaneously in the tricarboxylic acid (TCA) cycle and the electron transport chain. Its function involves binding to the SDHA (flavoprotein) subunit, which is already associated with FAD, thereby preventing excessive ROS generation. It further promotes the assembly of SDHA with the iron-sulfur protein SDHB to form the catalytic dimer. This ensures the proper integration of complex II into the inner mitochondrial membrane, allowing it to participate in both the TCA cycle and electron transport. Deficiency of SDHAF4 leads to reduced SDH activity, accumulation of succinate, and elevated mitochondrial superoxide levels, which are associated with certain cardiomyopathies and tumor metabolic reprogramming.