• Featured Product
  • KD/KO Validated

SDHB Polyclonal antibody

SDHB Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 10620-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

EC:1.3.5.1, Iron-sulfur subunit of complex II, PGL 4, PGL4, SDH

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, Jurkat cells, mouse liver tissue, rat liver tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10620-1-AP targets SDHB in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0968

Product name: Recombinant human SDHB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-280 aa of BC007840

Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

Predict reactive species
Full Name succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Calculated Molecular Weight 32 kDa
Observed Molecular Weight 28-32 kDa
GenBank Accession NumberBC007840
Gene Symbol SDHB
Gene ID (NCBI) 6390
RRIDAB_2285522
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21912
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SDHB(Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial) is also named as SDH, SDH1 and belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family. The SDHD, SDHB, and SDHC genes encode subunits of mitochondrial complex II (succinate dehydrogenase). Mitochondrial complex II is a heterotetrameric complex involved in the aerobic electron transport chain and catalyses the oxidation of succinate to fumarate (Krebs cycle) with transport of electrons to the ubiquinone pool. SDHA and SDHB are the hydrophilic catalytic part of the complex and are highly conserved(J Med Genet 2004;41:e99). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC), paragangliomas type 4 (PGL4), paraganglioma and gastric stromal sarcoma (PGGSS) and Cowden-like syndrome (CWDLS).

Protocols

Product Specific Protocols
WB protocol for SDHB antibody 10620-1-APDownload protocol
IHC protocol for SDHB antibody 10620-1-APDownload protocol
IF protocol for SDHB antibody 10620-1-APDownload protocol
IP protocol for SDHB antibody 10620-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Circ Res

Endothelial FUNDC1 Deficiency Drives Pulmonary Hypertension

Authors - Yandong Pei
humanWB

Nat Commun

Low chorionic villous succinate accumulation associates with recurrent spontaneous abortion risk.

Authors - Xiao-Hui Wang
  • KD Validated
mouseWB

Aging Dis

Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging

Authors - Minghao Yuan
ratWB,IF

Sci Total Environ

TRIM24-DTNBP1-ATP7A mediated astrocyte cuproptosis in cognition and memory dysfunction caused by Y2O3 NPs

Authors - Ziwei Chen
humanWB

Cell Death Dis

TGR5 supresses cGAS/STING pathway by inhibiting GRP75-mediated endoplasmic reticulum-mitochondrial coupling in diabetic retinopathy

Authors - Yan Li
mouseWB

Diabetes

CHCHD10 Modulates Thermogenesis of Adipocytes by Regulating Lipolysis

Authors - Meng Ding

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Baptiste (Verified Customer) (05-23-2025)

Working well but unspecific band at the top (+/- 38 kDa)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: Lymphoblastoid
SDHB Antibody Western Blot validation (1:10000 dilution) in Lymphoblastoid (Cat no:10620-1-AP)
FH

Edward (Verified Customer) (11-15-2022)

Used with 12 ug protein lysate SDHB works quite well, both with ECL detection and fluorescent secondary antibodies it gives a strong band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:8000
  • Cell Tissue Type: K562 and KCL22
FH

Lana (Verified Customer) (07-15-2020)

SDS-PAGE: 20 ug/ul RIPA protein lysate. 4-12% Bis-tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:5000.Secondary Ab: IRDye 800CW Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 - whole cell lysate, 3 – mitochondrial fraction lysate.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Mouse embryonic stem cells
SDHB Antibody Western Blot validation (1:5000 dilution) in Mouse embryonic stem cells (Cat no:10620-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...