Tested Applications
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26519-1-AP targets SDHD in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24644 Product name: Recombinant human SDHD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC012603 Sequence: MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASL Predict reactive species |
| Full Name | succinate dehydrogenase complex, subunit D, integral membrane protein |
| Calculated Molecular Weight | 17 kDa |
| GenBank Accession Number | BC012603 |
| Gene Symbol | SDHD |
| Gene ID (NCBI) | 6392 |
| RRID | AB_2880540 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14521 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SDHD antibody 26519-1-AP | Download protocol |
| IHC protocol for SDHD antibody 26519-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Lana (Verified Customer) (09-07-2020) | Antibody detects multiple bands as well as specific 17kDa SDHD band on WB.SDS-PAGE: 15 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:1000.Secondary Ab: IRDye 680LT Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 and 3 – mitochondrial fraction lysates.
![]() |




