Tested Applications
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26519-1-AP targets SDHD in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24644 Product name: Recombinant human SDHD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC012603 Sequence: MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASL Predict reactive species |
Full Name | succinate dehydrogenase complex, subunit D, integral membrane protein |
Calculated Molecular Weight | 17 kDa |
GenBank Accession Number | BC012603 |
Gene Symbol | SDHD |
Gene ID (NCBI) | 6392 |
RRID | AB_2880540 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14521 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for SDHD antibody 26519-1-AP | Download protocol |
IF protocol for SDHD antibody 26519-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Lana (Verified Customer) (09-07-2020) | Antibody detects multiple bands as well as specific 17kDa SDHD band on WB.SDS-PAGE: 15 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:1000.Secondary Ab: IRDye 680LT Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 and 3 – mitochondrial fraction lysates.
![]() |