Tested Applications
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26519-1-AP targets SDHD in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24644 Product name: Recombinant human SDHD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC012603 Sequence: MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASL Predict reactive species |
| Full Name | succinate dehydrogenase complex, subunit D, integral membrane protein |
| Calculated Molecular Weight | 17 kDa |
| GenBank Accession Number | BC012603 |
| Gene Symbol | SDHD |
| Gene ID (NCBI) | 6392 |
| RRID | AB_2880540 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14521 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SDHD antibody 26519-1-AP | Download protocol |
| IHC protocol for SDHD antibody 26519-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
The single review rates this antibody 4 out of 5 stars for Western Blot on mouse embryonic stem cells at a 1:1000 dilution. The reviewer reports that the antibody detects the expected 17 kDa SDHD band along with some additional non-specific bands. A detailed protocol was shared, including overnight primary antibody incubation at 4 °C, SEA Block for blocking, and IRDye 680LT secondary antibody at 1:15,000. Overall, the antibody performed adequately for its intended target, though some extra bands were observed.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lana (Verified Customer) (09-07-2020) | Antibody detects multiple bands as well as specific 17kDa SDHD band on WB.SDS-PAGE: 15 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:1000.Secondary Ab: IRDye 680LT Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 and 3 – mitochondrial fraction lysates.
 |
