SDHD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SDHD Polyclonal antibody (26519-1-AP)

SDHD Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 26519-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

CBT1, CII 4, CII4, CII-4, CybS

• 

  IHC staining of human liver using 26519-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26519-1-AP (SDHD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 26519-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26519-1-AP (SDHD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 26519-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SDHD antibody (26519-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26519-1-AP targets SDHD in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24644

  Product name: Recombinant human SDHD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-64 aa of BC012603

  Sequence: MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASL

• Full Name: succinate dehydrogenase complex, subunit D, integral membrane protein
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: BC012603
• Gene Symbol: SDHD
• Gene ID (NCBI): 6392
• RRID: AB_2880540
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14521
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Lana (Verified Customer) (09-07-2020)

Antibody detects multiple bands as well as specific 17kDa SDHD band on WB.SDS-PAGE: 15 ug/ul RIPA protein lysate, 4-12% Bis-Tris gradient gel.Transfer: Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4C.Blocking: SEA Block Blocking Buffer 1h, room T.Primary Ab: O/N incubation at 4C, 1:1000.Secondary Ab: IRDye 680LT Goat anti-Rabbit, 1:15000.Lines of WB image: 1 – protein ladder, 2 and 3 – mitochondrial fraction lysates.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse embryonic stem cells

SDHD Antibody Western Blot validation (1:1000 dilution) in Mouse embryonic stem cells (Cat no:26519-1-AP)