Tested Applications
| Positive WB detected in | mouse liver tissue, mouse lung tissue, rat lung tissue |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32098-1-AP targets SEC14L3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36792 Product name: Recombinant human SEC14L3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-182 aa of BC069641 Sequence: GLLFSVTKQDLLKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENY Predict reactive species |
| Full Name | SEC14-like 3 (S. cerevisiae) |
| Calculated Molecular Weight | 46 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC069641 |
| Gene Symbol | SEC14L3 |
| Gene ID (NCBI) | 266629 |
| RRID | AB_3670189 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9UDX4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SEC14L3 is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SEC14L3 antibody 32098-1-AP | Download protocol |
| IHC protocol for SEC14L3 antibody 32098-1-AP | Download protocol |
| WB protocol for SEC14L3 antibody 32098-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







