SEC5/EXOC2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 12751-1-AP (same clone as 12751-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12751-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12751-1-AP (same clone as 12751-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12751-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human ileum using 12751-1-AP (same clone as 12751-1-PBS)

  human ileum tissue were subjected to SDS PAGE followed by western blot with 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12751-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 12751-1-AP (same clone as 12751-1-PBS)

  IP result of anti-SEC5/EXOC2 (IP:12751-1-AP, 5ug; Detection:12751-1-AP 1:500) with mouse brain tissue lysate 3000ug. This data was developed using the same antibody clone with 12751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 12751-1-AP (same clone as 12751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12751-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12751-1-AP (same clone as 12751-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 12751-1-AP (SEC5/EXOC2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12751-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SEC5/EXOC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12751-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

12751-1-PBS targets SEC5/EXOC2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3147

  Product name: Recombinant human SEC5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 456-806 aa of BC016918

  Sequence: TIQDLILDLRVRCVMATLQHTAEEIKRLAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSINIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCYLERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIYAGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLMQCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELLNKFKSSMHLQLTCFQAASSTMMKT

• Full Name: exocyst complex component 2
• Calculated Molecular Weight: 924 aa, 104 kDa
• Observed Molecular Weight: 95-100 kDa
• GenBank Accession Number: BC016918
• Gene Symbol: SEC5
• Gene ID (NCBI): 55770
• RRID: AB_2262528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96KP1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EXOC2 (exocyst complex component 2), also known as SEC5 and SEC5L1, is a component of the exocyst complex, and is required to mediate RalB-dependent survival signals in transformed cells. The exocyst complex, composed of eight evolutionarily conserved subunits (SEC3, SEC5, SEC6, SEC8, SEC10, SEC15, EXO70, and EXO84), is involved in tethering post-Golgi secretory vesicles to specific plasma membrane domains. The gene of EXOC2 maps to chromosome 6p25.3, and encodes a 924-amino acid protein with an experimentally determined molecular mass of 95-100 kDa. EXOC2 mRNA is widely expressed with highest levels in brain and placenta.