Tested Applications
| Positive WB detected in | EC109 cells, HEK-293 cells, DC2.4 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 6 publications below |
| WB | See 17 publications below |
| IHC | See 8 publications below |
| IF | See 2 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
11147-2-AP targets SEC61G in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1624 Product name: Recombinant human SEC61G protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC009480 Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG Predict reactive species |
| Full Name | Sec61 gamma subunit |
| Calculated Molecular Weight | 7.7 kDa |
| Observed Molecular Weight | 7.7 kDa |
| GenBank Accession Number | BC009480 |
| Gene Symbol | SEC61G |
| Gene ID (NCBI) | 23480 |
| RRID | AB_2254450 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60059 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SEC61G is a subunit of the SEC61 complex, which also contains alpha (SEC61A) and beta (SEC61B) subunits. The SEC61 complex is the central component of the protein translocation apparatus on the endoplasmic reticulum membrane. The gene of SEC61G maps to chromosome 7p11.2, and encodes a 68-amino acid single-pass membrane protein. This antibody can recognize endogenous SEC61G that migrates at a molecular mass of ~8 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SEC61G antibody 11147-2-AP | Download protocol |
| WB protocol for SEC61G antibody 11147-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Immunity The translocon protein sec61 mediates antigen transport from endosomes in the cytosol for cross-presentation to CD8(+) T cells.
| ||
Proc Natl Acad Sci U S A Ablation of cholesterol biosynthesis in neural stem cells increases their VEGF expression and angiogenesis but causes neuron apoptosis. | ||
Proc Natl Acad Sci U S A A scalable strategy for high-throughput GFP tagging of endogenous human proteins. | ||
Cancer Res Glioblastoma proto-oncogene SEC61gamma is required for tumor cell survival and response to endoplasmic reticulum stress.
| ||
Elife An allosteric Sec61 inhibitor traps nascent transmembrane helices at the lateral gate. | ||
J Pathol Genome-wide analysis of DNA copy number alterations and gene expression in gastric cancer. |







