Product Information
67397-1-PBS targets SEMA7A in WB, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28804 Product name: Recombinant human SEMA7A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 371-423 aa of BC101643 Sequence: QPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGET Predict reactive species |
Full Name | semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) |
Calculated Molecular Weight | 666 aa, 75 kDa |
Observed Molecular Weight | 75-80 kDa |
GenBank Accession Number | BC101643 |
Gene Symbol | SEMA7A |
Gene ID (NCBI) | 8482 |
RRID | AB_2882640 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O75326 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
SEMA7A, also named CD108 and SEMAL, belongs to the semaphorin family. SEMA7A is the only membrane‐associated glycosylphosphatidylinositol (GPI)‐linked semaphorin and plays a role in the regulation of neuronal axon outgrowth. In addition to its role in guiding axon pathfinding during neuronal development, Sema7A has diverse functions in morphogenesis and immune cell control and regulates T cell responses via the α1β1 integrin receptor (PMID: 31179640). SEMA7A has 2 isoforms with molecular weights of 73 and 75 kDa, respectively.