Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Y79 cells, rat embryo tissue |
| Positive IP detected in | Y79 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
17659-1-AP targets SENP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11911 Product name: Recombinant human SENP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-574 aa of BC080658 Sequence: GLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV Predict reactive species |
| Full Name | SUMO1/sentrin/SMT3 specific peptidase 3 |
| Calculated Molecular Weight | 574 aa, 65 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC080658 |
| Gene Symbol | SENP3 |
| Gene ID (NCBI) | 26168 |
| RRID | AB_2301618 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H4L4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SENP3(Sentrin-specific protease 3) is also named as SSP3, SUSP3 and belongs to the peptidase C48 family. It acts as an essential factor for ribosome biogenesis. SENP3 might regulate the sumoylation of other substrates through directly binding or mediating association with NPM1 at the nucleolus and other subcellular compartments.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SENP3 antibody 17659-1-AP | Download protocol |
| IP protocol for SENP3 antibody 17659-1-AP | Download protocol |
| WB protocol for SENP3 antibody 17659-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Differ Redox regulation of TRIM28 facilitates neuronal ferroptosis by promoting SUMOylation and inhibiting OPTN-selective autophagic degradation of ACSL4 | ||
Mol Cell Proteomics Five friends of methylated chromatin target of protein-arginine-methyltransferase[prmt]-1 (chtop), a complex linking arginine methylation to desumoylation. | ||
Int J Oncol Transcription factor E2F4 facilitates SUMOylation to promote HCC progression through interaction with LIN9 | ||
FASEB J SUMO1 SUMOylates and SENP3 deSUMOylates NLRP3 to orchestrate the inflammasome activation. | ||
Breast Cancer Res Treat Targeting PELP1 oncogenic signaling in TNBC with the small molecule inhibitor SMIP34 | ||
iScience SENP3-mediated deSUMOylation of c-Jun facilitates microglia-induced neuroinflammation after cerebral ischemia and reperfusion injury
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Chun (Verified Customer) (07-03-2019) | This antibody is excellent.
|









