Tested Applications
| Positive WB detected in | HepG2 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
11691-1-AP targets SERF2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2305 Product name: Recombinant human SERF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC022326 Sequence: MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK Predict reactive species |
| Full Name | small EDRK-rich factor 2 |
| Calculated Molecular Weight | 59 aa, 7 kDa |
| GenBank Accession Number | BC022326 |
| Gene Symbol | SERF2 |
| Gene ID (NCBI) | 10169 |
| RRID | AB_10596937 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P84101 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SERF2 Belongs to the SERF family. The antibody is specific to SERF2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SERF2 antibody 11691-1-AP | Download protocol |
| IHC protocol for SERF2 antibody 11691-1-AP | Download protocol |
| IP protocol for SERF2 antibody 11691-1-AP | Download protocol |
| WB protocol for SERF2 antibody 11691-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mamm Genome A novel knockout mouse for the small EDRK-rich factor 2 (Serf2) showing developmental and other deficits.
| ||
Life Sci Alliance Deletion of SERF2 in mice delays embryonic development and alters amyloid deposit structure in the brain |









