SERF2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SERF2 Polyclonal antibody (11691-1-AP)

• Featured Product
• KD/KO Validated

SERF2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11691-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

small EDRK rich factor 2, Protein 4F5-related, Protein 4F5 related, h4F5rel, Gastric cancer-related protein VRG107

• 

  WB analysis of HepG2 using 11691-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11691-1-AP (SERF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HepG2 using 11691-1-AP

  IP result of anti-SERF2 (IP:11691-1-AP, 4ug; Detection:11691-1-AP 1:500) with HepG2 cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 11691-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 11691-1-AP (SERF2 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 11691-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SERF2 antibody (11691-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 11691-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using SERF2 antibody (11691-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SERF2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11691-1-AP targets SERF2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2305

  Product name: Recombinant human SERF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC022326

  Sequence: MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK

• Full Name: small EDRK-rich factor 2
• Calculated Molecular Weight: 59 aa, 7 kDa
• GenBank Accession Number: BC022326
• Gene Symbol: SERF2
• Gene ID (NCBI): 10169
• RRID: AB_10596937
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P84101
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SERF2 Belongs to the SERF family. The antibody is specific to SERF2.

Publications

What published studies show

Anti-SERF2 antibody (Cat# 11691-1-AP) has 4 published citations appearing in Nature Communications, Life Science Alliance, Mammalian Genome, and bioRxiv. Associated research fields include liquid-liquid phase separation/phase transitions, embryonic development, amyloid deposit structure in the brain, and neurodegeneration. Applications utilized were immunofluorescence (IF) and Western blot (WB), with reactivity demonstrated in mouse and human samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Nat Commun; Visualization of liquid-liquid phase transitions using a tiny G-quadruplex binding protein; Authors - Bikash R Sahoo
mouse	WB	Life Sci Alliance; Deletion of SERF2 in mice delays embryonic development and alters amyloid deposit structure in the brain; Authors - Esther Stroo
mouse	WB	Mamm Genome; A novel knockout mouse for the small EDRK-rich factor 2 (Serf2) showing developmental and other deficits.; Authors - Karen Cleverley ; KD Validated
human	IF	bioRxiv; Visualizing liquid-liquid phase transitions; Authors - Bikash R Sahoo ; KD Validated