Tested Applications
| Positive WB detected in | human testis tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28271-1-AP targets SFRP1 in WB, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag28072 Product name: Recombinant human SFRP1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 154-314 aa of BC036503 Sequence: MLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK Predict reactive species | 
                                    
| Full Name | secreted frizzled-related protein 1 | 
| Calculated Molecular Weight | 314 aa, 35 kDa | 
| Observed Molecular Weight | 30-35 kDa | 
| GenBank Accession Number | BC036503 | 
| Gene Symbol | SFRP1 | 
| Gene ID (NCBI) | 6422 | 
| RRID | AB_2881100 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q8N474 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SFRP1 antibody 28271-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

