SFRP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SFRP1 Polyclonal antibody (28271-1-AP)

SFRP1 Polyclonal Antibody for WB, ELISA

Cat No. 28271-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

FRP1, FRP-1, SARP2, SARP-2, Secreted apoptosis-related protein 2

• 

  WB analysis of human testis using 28271-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 28271-1-AP (SFRP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28271-1-AP targets SFRP1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28072

  Product name: Recombinant human SFRP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 154-314 aa of BC036503

  Sequence: MLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK

• Full Name: secreted frizzled-related protein 1
• Calculated Molecular Weight: 314 aa, 35 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC036503
• Gene Symbol: SFRP1
• Gene ID (NCBI): 6422
• RRID: AB_2881100
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N474
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SFRP1 (Secreted Frizzled-Related Protein 1) is a secreted glycoprotein that functions as a key modulator of the Wnt signaling pathway. The SFRP1 protein harbors two independent structural domains, namely the carboxy-terminal netrin (NTR) domain and an amino-terminal cysteine-rich domain (CRD). Secreted SFRP1 is an inhibitor of the Wnt signalling pathway and has been classified as a tumor suppressor gene due to the loss of its expression in many human cancers (PMID: 32074995). SFRP1 is necessary for stress-induced senescence caused by these factors and is sufficient for the induction of senescence phenotypes.