SFRP4 Polyclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 15328-1-AP (same clone as 15328-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15328-1-AP (SFRP4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15328-1-AP (same clone as 15328-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15328-1-AP (SFRP4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 15328-1-AP (same clone as 15328-1-PBS)

  IP result of anti-SFRP4 (IP:15328-1-AP, 4ug; Detection:15328-1-AP 1:500) with HeLa cells lysate 2000ug. This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15328-1-AP (same clone as 15328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15328-1-AP (SFRP4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15328-1-AP (same clone as 15328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15328-1-AP (SFRP4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat testis using 15328-1-AP (same clone as 15328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 15328-1-AP (SFRP4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 15328-1-AP (same clone as 15328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15328-1-AP (SFRP4 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 15328-1-AP (same clone as 15328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15328-1-AP (SFRP4 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 15328-1-AP (same clone as 15328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15328-1-AP (SFRP4 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 15328-1-AP (same clone as 15328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 15328-1-AP (SFRP4 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15328-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SFRP4 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15328-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

15328-1-PBS targets SFRP4 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6909

  Product name: Recombinant human SFRP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-346 aa of BC058911

  Sequence: MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV

• Full Name: secreted frizzled-related protein 4
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 41-51 kDa, 55 kDa
• GenBank Accession Number: BC058911
• Gene Symbol: SFRP4
• Gene ID (NCBI): 6424
• RRID: AB_2187099
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6FHJ7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRP4 functions as a suppressor of tumor growth via inhibition of the Wnt signaling pathway.Downregulation or deletion of SFRP4 has been reported in several cancers and cell lines such as endometrial cancer, ovarian cancer, lung cancer,and others. This antibody got 41-51 kDa and 55 kDa bands in western blotting maybe due to differential posttranslational protein modification.