SFRS11 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83605-6-RR (same clone as 83605-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83605-6-RR (SFRS11 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83605-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83605-6-RR (same clone as 83605-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SFRS11 antibody (83605-6-RR, Clone: 240465B8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83605-6-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83605-6-RR (same clone as 83605-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SFRS11 antibody (83605-6-RR, Clone: 240465B8 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83605-6-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83605-6-RR (same clone as 83605-6-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug SFRS11 Recombinant antibody (83605-6-RR, Clone:240465B8) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83605-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83605-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83605-6-RR against Human SFRS11 were performed. The affinity constant is 1.37 nM.

SFRS11 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83605-6-PBS

Clone No.240465B8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

SRSF11, Splicing factor, arginine/serine-rich 11, Serine/arginine-rich splicing factor 11, p54, Arginine-rich 54 kDa nuclear protein

---

Product Information

83605-6-PBS targets SFRS11 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24932

  Product name: Recombinant human SFRS11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 398-483 aa of BC040436

  Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD

• Full Name: splicing factor, arginine/serine-rich 11
• Calculated Molecular Weight: 483 aa, 53 kDa
• GenBank Accession Number: BC040436
• Gene Symbol: SFRS11
• Gene ID (NCBI): 9295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q05519
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.