Surfactant Protein A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Surfactant Protein A Polyclonal antibody (11850-1-AP)

Surfactant Protein A Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 11850-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF-P, ELISA
For FC, select conjugated version.

Synonyms

SFTPA1, SFTPA2, 35 kDa pulmonary surfactant-associated protein, COLEC4, Collectin 4

• 

  IHC staining of human lung using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11850-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 11850-1-AP (Surfactant Protein A antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 11850-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Surfactant Protein A antibody (11850-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Surfactant Protein A in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human lung tissue, human heart tissue, human kidney tissue, human placenta tissue, human skin tissue, human brain tissue, human spleen tissue, human ovary tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11850-1-AP targets Surfactant Protein A in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2417

  Product name: Recombinant human SFTPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-248 aa of BC026229

  Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

• Full Name: surfactant protein A1
• Calculated Molecular Weight: 248 aa, 26 kDa
• GenBank Accession Number: BC026229
• Gene Symbol: Surfactant Protein A
• Gene ID (NCBI): 653509
• RRID: AB_2185360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWL2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Surfactant protein A (SP-A), is the major protein component of pulmonary surfactant involved in surfactant-related function or structure and in the regulation of inflammatory processes and innate host defens. In humans and primates, SP-A1 (SFTPA1) and SP-A2 (SFTPA2) genes encode SP-A, and these two SP-A genes have high homology (PMID: 34484180, PMID: 19392648). This antibody can recognize both SP-A1 (SFTPA1) and SP-A2 (SFTPA2).

Publications

What published studies show

The Surfactant Protein A (SP-A) Polyclonal Antibody (Cat# 11850-1-AP) has 11 citations published in journals including Science of the Total Environment, Journal of Genetics and Genomics, Cancer Immunology & Immunotherapy, International Journal of Molecular Sciences, Scientific Reports, Environmental Toxicology, Kaohsiung Journal of Medical Sciences, Biochemical and Biophysical Research Communications, Journal of Thoracic Disease, Frontiers in Pediatrics, and Journal of Molecular Histology. Research fields span pulmonary fibrosis, lung development, lung adenocarcinoma immunotherapy, alveolar epithelial biology, acute lung injury, bronchopulmonary dysplasia, and acute kidney injury.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Sci Total Environ; Protein lysine acetylation played an important role in NH3-induced AEC2 damage and pulmonary fibrosis in piglets; Authors - Xiaotong Wang
		J Genet Genomics; Tapt1 deficiency in mice impairs pulmonary lipid homeostasis and normal postnatal respiration by targeting ABCA3 for autophagy-lysosomal degradation.; Authors - Dandan Tan
mouse,human	IHC	Cancer Immunol Immunother; SFTPA1 is a potential prognostic biomarker correlated with immune cell infiltration and response to immunotherapy in lung adenocarcinoma.; Authors - Lu Yuan
mouse	WB	Int J Mol Sci; Kub3 Deficiency Causes Aberrant Late Embryonic Lung Development in Mice by the FGF Signaling Pathway.; Authors - Guangying Yang
		Sci Rep; Uridine alleviates the aging of alveolar epithelial cells in idiopathic pulmonary fibrosis through the Keap1-Nrf2 signaling pathway.; Authors - Chenchun Ding
human	WB	Environ Toxicol; Silica nanoparticle exposure inhibits surfactant protein A and B in A549 cells through ROS-mediated JNK/c-Jun signaling pathway.; Authors - Xiaojing Yang