CoraLite® Plus 488-conjugated Surfactant Protein A Polyclonal antibody

• 

  FC experiment of A549 using CL488-11850

  1x10^6 A549 cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human Surfactant Protein A (CL488-11850)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Surfactant Protein A Polyclonal Antibody for FC (Intra)

Cat No. CL488-11850

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

SFTPA1, SFTPA2, 35 kDa pulmonary surfactant-associated protein, COLEC4, Collectin 4

---

Tested Applications

• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11850 targets Surfactant Protein A in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2417

  Product name: Recombinant human SFTPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-248 aa of BC026229

  Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

• Full Name: surfactant protein A1
• Calculated Molecular Weight: 248 aa, 26 kDa
• GenBank Accession Number: BC026229
• Gene Symbol: Surfactant Protein A
• Gene ID (NCBI): 653509
• RRID: AB_3672515
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWL2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Surfactant protein A (SP-A), is the major protein component of pulmonary surfactant involved in surfactant-related function or structure and in the regulation of inflammatory processes and innate host defens. In humans and primates, SP-A1 (SFTPA1) and SP-A2 (SFTPA2) genes encode SP-A, and these two SP-A genes have high homology (PMID: 34484180, PMID: 19392648). This antibody can recognize both SP-A1 (SFTPA1) and SP-A2 (SFTPA2).