CoraLite® Plus 488-conjugated Surfactant Protein A Polyclonal antibody

Surfactant Protein A Polyclonal Antibody for FC (Intra)
Cat No. CL488-11850

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Alveolar proteinosis protein, COLEC4, Collectin 4, FLJ51913, PSAP, PSP A, PSPA, SFTP1, SFTPA, SFTPA1, SFTPA1B, SFTPA2, SP A, SP A1, Surfactant Protein A, surfactant protein A1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA549 cells
Positive FC detected inA549 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11850 targets Surfactant Protein A in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2417

Product name: Recombinant human SFTPA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 132-248 aa of BC026229

Sequence: MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Predict reactive species
Full Name surfactant protein A1
Calculated Molecular Weight 248 aa, 26 kDa
GenBank Accession NumberBC026229
Gene Symbol Surfactant Protein A
Gene ID (NCBI) 653509
RRIDAB_3672515
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IWL2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Surfactant protein A (SP-A), is the major protein component of pulmonary surfactant involved in surfactant-related function or structure and in the regulation of inflammatory processes and innate host defens. In humans and primates, SP-A1 (SFTPA1) and SP-A2 (SFTPA2) genes encode SP-A, and these two SP-A genes have high homology (PMID: 34484180, PMID: 19392648). This antibody can recognize both SP-A1 (SFTPA1) and SP-A2 (SFTPA2).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Surfactant Protein A antibody CL488-11850Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...