SGOL1 Polyclonal antibody, PBS Only

• 

  WB analysis using 16977-1-AP (same clone as 16977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16977-1-AP (SGOL1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16977-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 16977-1-AP (same clone as 16977-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16977-1-AP (SGOL1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16977-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 16977-1-AP (same clone as 16977-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SGOL1 antibody (16977-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 16977-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SGOL1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16977-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

hSgo1, NY BR 85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1

---

Product Information

16977-1-PBS targets SGOL1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9700

  Product name: Recombinant human SGOL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-292 aa of BC017867

  Sequence: MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR

• Full Name: shugoshin-like 1 (S. pombe)
• Calculated Molecular Weight: 561aa,64 kDa; 292aa,34 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC017867
• Gene Symbol: SGOL1
• Gene ID (NCBI): 151648
• RRID: AB_2188437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5FBB7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SGOL1 (Shugoshin 1), a centromeric protein, plays an important role in mitosis (PMID: 23102702).