SGOL1 Polyclonal antibody

• 

  WB analysis using 16977-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16977-1-AP (SGOL1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 16977-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16977-1-AP (SGOL1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 16977-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SGOL1 antibody (16977-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

SGOL1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 16977-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

hSgo1, NY BR 85, Serologically defined breast cancer antigen NY-BR-85, SGO, SGO1

---

Tested Applications

• Positive WB detected in: HeLa cells, PC-3 cells, NIH/3T3 cells, mouse heart tissue, rat heart tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IHC: See 4 publications below
• IF: See 3 publications below

Product Information

16977-1-AP targets SGOL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9700

  Product name: Recombinant human SGOL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-292 aa of BC017867

  Sequence: MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR

• Full Name: shugoshin-like 1 (S. pombe)
• Calculated Molecular Weight: 561aa,64 kDa; 292aa,34 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC017867
• Gene Symbol: SGOL1
• Gene ID (NCBI): 151648
• RRID: AB_2188437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5FBB7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SGOL1 (Shugoshin 1), a centromeric protein, plays an important role in mitosis (PMID: 23102702).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Death Dis; Genome-wide CRISPR screen identifies BUB1 kinase as a druggable vulnerability in malignant pleural mesothelioma; Authors - Ece Cakiroglu
mouse	WB,IHC	Carcinogenesis; Tumor-promoting/progressing role of additional chromosome instability in hepatic carcinogenesis in Sgo1 (Shugoshin 1) haploinsufficient mice.; Authors - Hiroshi Y Yamada
human	IHC	Front Oncol; Deciphering the Role of Shugoshin-Like Protein 1 in Lung Adenocarcinoma: A Comprehensive Analysis and In Vitro Study.; Authors - Yixiao Yuan
mouse	IHC	Mol Carcinog; Antagonizing pathways leading to differential dynamics in colon carcinogenesis in Shugoshin1 (Sgo1)-haploinsufficient chromosome instability model.; Authors - Chinthalapally V Rao
human	WB,IHC,IF	BMC Med Genomics; Prognosis and biological function of SGOL1 in clear cell renal cell carcinoma: a multiomics analysis; Authors - Zezhong Yang ; KD Validated
human	WB	Gene; Integrative analysis of bulk RNA and single-cell sequencing data reveals a liquid-liquid phase separation signature for clear cell renal cell carcinoma; Authors - Hongbo Wang