Tested Applications
Positive IHC detected in | human skin cancer tissue, human cervical cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 7 publications below |
IHC | See 3 publications below |
IF | See 1 publications below |
Product Information
13639-1-AP targets DSS1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4573 Product name: Recombinant human SHFM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC032782 Sequence: MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS Predict reactive species |
Full Name | split hand/foot malformation (ectrodactyly) type 1 |
Calculated Molecular Weight | 70 aa, 8 kDa |
GenBank Accession Number | BC032782 |
Gene Symbol | DSS1 |
Gene ID (NCBI) | 7979 |
RRID | AB_2254633 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P60896 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for DSS1 antibody 13639-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nature BRCA2 prevents R-loop accumulation and associates with TREX-2 mRNA export factor PCID2.
| ||
EMBO J The proteasomal de-ubiquitinating enzyme POH1 promotes the double-strand DNA break response. | ||
J Med Genet Absent expression of the osteoblast-specific maternally imprinted genes, DLX5 and DLX6, causes split hand/split foot malformation type I. | ||
Lab Invest Increased chemosensitivity via BRCA2-independent DNA damage in DSS1- and PCID2-depleted breast carcinomas.
| ||
BMC Cancer Breast cancers with high DSS1 expression that potentially maintains BRCA2 stability have poor prognosis in the relapse-free survival. | ||
Protein Cell DSSylation, a novel protein modification targets proteins induced by oxidative stress, and facilitates their degradation in cells. |