Product Information
83389-4-PBS targets SIAH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34618 Product name: Recombinant human SIAH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC035562 Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLP Predict reactive species |
| Full Name | seven in absentia homolog 1 (Drosophila) |
| Calculated Molecular Weight | 282 aa, 31 kDa |
| Observed Molecular Weight | 30-34 kDa |
| GenBank Accession Number | BC035562 |
| Gene Symbol | SIAH1 |
| Gene ID (NCBI) | 6477 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q8IUQ4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SIAH1, also named as HUMSIAH, Siah-1a and Siah-1S(21kd), belongs to the SINA (Seven in absentia) family. SIAH1 is known to cause indirect degradation of beta-catenin through formation of a complex with Siah-interacting protein (SIP), Skp1 and Ebi. SIAH1 can form heterodimer or homodimer such as Siah-1*Siah-1(70 or 62kd), Siah-1*Siah-1S(42kd) and Siah-1S*Siah-1S(51-56kd). Importantly, results from in vitro soft agar assay demonstrated that Siah-1S displays a promotion effect on cells tumorigenicity. (PMID:17420721)









