SIN3A Monoclonal antibody

• 

  WB analysis using 67197-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67197-1-Ig (SIN3A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67197-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67197-1-Ig (SIN3A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67197-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67197-1-Ig (SIN3A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of 4T1 using 67197-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 67197-1-Ig (SIN3A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 67197-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SIN3A antibody (67197-1-Ig, Clone: 2B12E8 ) at dilution of 1:2500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

SIN3A Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67197-1-Ig

Clone No.2B12E8

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

DKFZp434K2235, FLJ90319, KIAA0700, SIN3A

---

Tested Applications

• Positive WB detected in: HeLa cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, HEK-293 cells, MCF-7 cells, Jurkat cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1250-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67197-1-Ig targets SIN3A in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28865

  Product name: Recombinant human SIN3A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-156 aa of BC066364

  Sequence: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVVFSSFSWVKKFIFSRKYWLQLVGCGGTTSNLRY

• Full Name: SIN3 homolog A, transcription regulator (yeast)
• Calculated Molecular Weight: 145 kDa
• Observed Molecular Weight: 145-150 kDa
• GenBank Accession Number: BC066364
• Gene Symbol: SIN3A
• Gene ID (NCBI): 25942
• RRID: AB_2882490
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96ST3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.