CoraLite® Plus 488-conjugated SIN3A Monoclonal antibody

• 

  FC experiment of A431 using CL488-67197

  1X10^6 A431 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human SIN3A (CL488-67197, Clone:2B12E8) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

SIN3A Monoclonal Antibody for FC (Intra)

Cat No. CL488-67197

Clone No.2B12E8

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

FC (Intra)

Synonyms

SIN3A, 2B12E8, KIAA0700

---

Tested Applications

• Positive FC (Intra) detected in: A431 cells
• Positive FC detected in: A431 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67197 targets SIN3A in FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28865

  Product name: Recombinant human SIN3A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-156 aa of BC066364

  Sequence: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVVFSSFSWVKKFIFSRKYWLQLVGCGGTTSNLRY

• Full Name: SIN3 homolog A, transcription regulator (yeast)
• Calculated Molecular Weight: 145 kDa
• Observed Molecular Weight: 145-150 kDa
• GenBank Accession Number: BC066364
• Gene Symbol: SIN3A
• Gene ID (NCBI): 25942
• RRID: AB_3084323
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96ST3
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.