Tested Applications
| Positive WB detected in | fetal human brain tissue |
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26594-1-AP targets SIRPD in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24246 Product name: Recombinant human SIRPD protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-110 aa of BC033502 Sequence: FHVQQTEMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLA Predict reactive species |
| Full Name | signal-regulatory protein delta |
| Calculated Molecular Weight | 197 aa, 22 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC033502 |
| Gene Symbol | SIRPD |
| Gene ID (NCBI) | 128646 |
| RRID | AB_2880567 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H106 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SIRPD antibody 26594-1-AP | Download protocol |
| IHC protocol for SIRPD antibody 26594-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





