Tested Applications
Positive WB detected in | fetal human brain tissue |
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26594-1-AP targets SIRPD in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24246 Product name: Recombinant human SIRPD protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 30-110 aa of BC033502 Sequence: FHVQQTEMSQTVSTGESIILSCSVPDTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLA Predict reactive species |
Full Name | signal-regulatory protein delta |
Calculated Molecular Weight | 197 aa, 22 kDa |
Observed Molecular Weight | 19 kDa |
GenBank Accession Number | BC033502 |
Gene Symbol | SIRPD |
Gene ID (NCBI) | 128646 |
RRID | AB_2880567 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H106 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SIRPD antibody 26594-1-AP | Download protocol |
IHC protocol for SIRPD antibody 26594-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |