Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SIRT1 Monoclonal antibody

SIRT1 Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 60303-1-Ig
Clone No. 7F6G6
Publications (108)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

NAD-dependent protein deacetylase sirtuin-1, hSIRT1, hSIR2, EC:2.3.1.286, EC:2.3.1.-

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SIRT1 in ?

Tested Applications

Positive WB detected inA549 cells, HeLa cells, Hek-293 cells, LNCaP cells, Jurkat cells, MCF-7 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue, human testis tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inBT-549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60303-1-Ig targets SIRT1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17677

Product name: Recombinant human SIRT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-350 aa of BC012499

Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE

Predict reactive species
Full Name sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
Calculated Molecular Weight 747 aa, 82 kDa
Observed Molecular Weight 110-130 kDa
GenBank Accession NumberBC012499
Gene Symbol SIRT1
Gene ID (NCBI) 23411
RRIDAB_2881417
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96EB6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SIRT1, also named as SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SIRT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SIRT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin and inner membrane. It can shuttles between nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including: activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition SIRT1 activation elicits resistance to oxidative stress via regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382.

Protocols

Product Specific Protocols
IF protocol for SIRT1 antibody 60303-1-IgDownload protocol
IHC protocol for SIRT1 antibody 60303-1-IgDownload protocol
IP protocol for SIRT1 antibody 60303-1-IgDownload protocol
WB protocol for SIRT1 antibody 60303-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-SIRT1 antibody (Cat# 60303-1-Ig) has 108 citations published in journals including Nature Communications, Nature Aging, Cell Metabolism, PNAS, Advanced Science, Cell Reports, Metabolism, Redox Biology, Microbiome, International Journal of Molecular Sciences, Phytomedicine, Free Radical Biology and Medicine, Stem Cell Research & Therapy, and more. Associated research fields include aging, NAD⁺ metabolism, cardiovascular disease, neuroprotection, cancer, reproductive biology, liver fibrosis, diabetes, osteoporosis, kidney injury, oxidative stress, ferroptosis, autophagy, and porcine embryology.

SpeciesApplicationTitle
WB

Cell Metab

Garlic-derived metabolite activates LKB1, promotes adipose eNAMPT secretion, and improves age-related muscle function via hypothalamic signaling.

Authors - Jun-ichiro Suzuki

Nat Aging

NADase CD38 is a key determinant of ovarian aging

Authors - Qingling Yang
humanELISA

Nat Commun

Phenylalanine impairs insulin signaling and inhibits glucose uptake through modification of IRβ.

Authors - Qian Zhou
WB,IHC

Metabolism

Fyn deficiency inhibits oxidative stress by decreasing c-Cbl-mediated ubiquitination of Sirt1 to attenuate diabetic renal fibrosis

Authors - Shanshan Li
WB

Redox Biol

Oxidative stress-induced ZEB1 acetylation drives a hybrid epithelial-mesenchymal phenotype and promotes lung metastasis in triple-negative breast cancer

Authors - Min Guo
pigWB

Microbiome

Microbiota governs host chenodeoxycholic acid glucuronidation to ameliorate bile acid disorder induced diarrhea

Authors - Zishen Lin
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...