Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, Hek-293 cells, LNCaP cells, Jurkat cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human testis tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | BT-549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60303-1-Ig targets SIRT1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17677 Product name: Recombinant human SIRT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-350 aa of BC012499 Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE Predict reactive species |
| Full Name | sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) |
| Calculated Molecular Weight | 747 aa, 82 kDa |
| Observed Molecular Weight | 110-130 kDa |
| GenBank Accession Number | BC012499 |
| Gene Symbol | SIRT1 |
| Gene ID (NCBI) | 23411 |
| RRID | AB_2881417 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96EB6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SIRT1, also named as SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SIRT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SIRT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin and inner membrane. It can shuttles between nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including: activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition SIRT1 activation elicits resistance to oxidative stress via regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| IHC protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| IP protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| WB protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SIRT1 antibody (Cat# 60303-1-Ig) has 108 citations published in journals including Nature Communications, Nature Aging, Cell Metabolism, PNAS, Advanced Science, Cell Reports, Metabolism, Redox Biology, Microbiome, International Journal of Molecular Sciences, Phytomedicine, Free Radical Biology and Medicine, Stem Cell Research & Therapy, and more. Associated research fields include aging, NAD⁺ metabolism, cardiovascular disease, neuroprotection, cancer, reproductive biology, liver fibrosis, diabetes, osteoporosis, kidney injury, oxidative stress, ferroptosis, autophagy, and porcine embryology.
| Species | Application | Title |
|---|---|---|
Cell Metab Garlic-derived metabolite activates LKB1, promotes adipose eNAMPT secretion, and improves age-related muscle function via hypothalamic signaling. | ||
Nat Commun Phenylalanine impairs insulin signaling and inhibits glucose uptake through modification of IRβ. | ||
Metabolism Fyn deficiency inhibits oxidative stress by decreasing c-Cbl-mediated ubiquitination of Sirt1 to attenuate diabetic renal fibrosis | ||
Redox Biol Oxidative stress-induced ZEB1 acetylation drives a hybrid epithelial-mesenchymal phenotype and promotes lung metastasis in triple-negative breast cancer | ||
Microbiome Microbiota governs host chenodeoxycholic acid glucuronidation to ameliorate bile acid disorder induced diarrhea
|





















