Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, Hek-293 cells, LNCaP cells, Jurkat cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human testis tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | BT-549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 80 publications below |
| IHC | See 11 publications below |
| IF | See 23 publications below |
| IP | See 2 publications below |
| ELISA | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
60303-1-Ig targets SIRT1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17677 Product name: Recombinant human SIRT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-350 aa of BC012499 Sequence: MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGALFSQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPE Predict reactive species |
| Full Name | sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) |
| Calculated Molecular Weight | 747 aa, 82 kDa |
| Observed Molecular Weight | 110-130 kDa |
| GenBank Accession Number | BC012499 |
| Gene Symbol | SIRT1 |
| Gene ID (NCBI) | 23411 |
| RRID | AB_2881417 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96EB6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SIRT1, also named as SIR2L1, contains a deacetylase sirtuin-type domain and belongs to the sirtuin family. The post-translation modified SIRT1 is a 110-130 kDa protein, which contains one deacetylase sirtuin-type domain. The 75-80 kDa SIRT1 fragment was detected to lack the carboxy-terminus (PMID:21305533). SIRT1 exists a 57-61 kDa isoform. SIRT1 may be found in nucleolus, nuclear euchromatin, heterochromatin and inner membrane. It can shuttles between nucleus and cytoplasm. SIRT1 regulates processes such as apoptosis and muscle differentiation by deacetylating key proteins. SIRT1 in particular initiates several signaling events relevant to cardioprotection, including: activation of endothelial nitric oxide synthase, INS receptor signaling, and autophagy. In addition SIRT1 activation elicits resistance to oxidative stress via regulation of transcription factors and co-activators such as FOXO, Hif-2a, and NF-kB. SIRT1 regulates the p53-dependent DNA damage response pathway by binding to and deacetylating p53, specifically at Lysine 382.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| IHC protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| IP protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| WB protocol for SIRT1 antibody 60303-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Pineal Res Melatonin Protects Mouse Testes from Palmitic Acid-Induced Lipotoxicity by Attenuating Oxidative Stress and DNA Damage in a SIRT1-Dependent Manner. | ||
Adv Sci (Weinh) H2O2-Activated Serotonin Precursor Probe for Mapping Neuronal Redox Homeostasis Reveals 5-HT Interactions with Neighboring Proteins Under Oxidative Stress | ||
Int J Biol Macromol Buckwheat protein-derived peptide ameliorates insulin resistance by directing O-linked N-acetylglucosamine transferase to regulate the SIRT1/PGC1α pathway | ||
Free Radic Biol Med Menaquinone-4 prevents medication-related osteonecrosis of the jaw through the SIRT1 signaling-mediated inhibition of cellular metabolic stresses-induced osteoblast apoptosis | ||
Int J Mol Sci Exposure to Bisphenol A Caused Hepatoxicity and Intestinal Flora Disorder in Rats. | ||
Int J Mol Sci COX-2/sEH Dual Inhibitor Alleviates Hepatocyte Senescence in NAFLD Mice by Restoring Autophagy through Sirt1/PI3K/AKT/mTOR. |





















