SLC10A5 Polyclonal antibody

• 

  IHC staining of mouse heart using 25597-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25597-1-AP (SLC10A5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 25597-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 25597-1-AP (SLC10A5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC10A5 Polyclonal Antibody for IHC, ELISA

Cat No. 25597-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

P5

---

Tested Applications

• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25597-1-AP targets SLC10A5 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22339

  Product name: Recombinant human SLC10A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-141 aa of BC136625

  Sequence: ARMSSLSFLNIEKTEILFFTKTEETILVSSSYENKRPNSSHLFVKIEDPKILQMVNVAKKISSDATNFTINLVTDEEGETNVTIQLWDSEGRQERLIEEIKNVKVKVLKQKDSLLQAPMHIDR

• Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 5
• Calculated Molecular Weight: 438 aa, 49 kDa
• GenBank Accession Number: BC136625
• Gene Symbol: SLC10A5
• Gene ID (NCBI): 347051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5PT55
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute Carrier Family 10 Member 5 (SLC10A5) is a member of SLC10, comprising transporters of bile acids, steroidal hormones, and other substrates. SLC10A5 is involved in the uptake of bile acid, and its deficiency causes hypercholanemia(PMID: 38986003).