Tested Applications
Positive WB detected in | mouse liver tissue |
Positive IHC detected in | mouse heart tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27938-1-AP targets SLC10A6 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.
Tested Reactivity | Human, Mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16609 Product name: Recombinant human SLC10A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-377 aa of BC107051 Sequence: GFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE Predict reactive species |
Full Name | solute carrier family 10 (sodium/bile acid cotransporter family), member 6 |
Calculated Molecular Weight | 377 aa, 41 kDa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | BC107051 |
Gene Symbol | SLC10A6 |
Gene ID (NCBI) | 345274 |
RRID | AB_2881014 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q3KNW5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC10A6, also named as SOAT, belongs to the SlC10 sodium-dependent bile acid (BA) transporter family. SLC10A6 is a transporter of steroid sulfates associated with spermatogenesis and fertility. It has been shown that SLC10A6 might be a new anti-proliferative breast cancer target as the SLC10A6 inhibition can affect the proliferation of breast cancer cells. SLC10A6 also plays a key role in hepatic inflammation. 27938-1-AP antibody detects the 70 kDa glycosylated form in SDS-PAGE. (PMID: 26510996, 30186172, 28893621)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC10A6 antibody 27938-1-AP | Download protocol |
IHC protocol for SLC10A6 antibody 27938-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |