SLC10A6 Polyclonal antibody

• 

  WB analysis of mouse liver using 27938-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27938-1-AP (SLC10A6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 27938-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 27938-1-AP (SLC10A6 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 27938-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 27938-1-AP (SLC10A6 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27938-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27938-1-AP (SLC10A6 antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 27938-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27938-1-AP (SLC10A6 antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC10A6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27938-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse

Applications

WB, IHC, ELISA

Synonyms

SLC10A6, SOAT

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: mouse heart tissue, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27938-1-AP targets SLC10A6 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16609

  Product name: Recombinant human SLC10A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 301-377 aa of BC107051

  Sequence: GFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE

• Full Name: solute carrier family 10 (sodium/bile acid cotransporter family), member 6
• Calculated Molecular Weight: 377 aa, 41 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC107051
• Gene Symbol: SLC10A6
• Gene ID (NCBI): 345274
• RRID: AB_2881014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3KNW5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC10A6, also named as SOAT, belongs to the SlC10 sodium-dependent bile acid (BA) transporter family. SLC10A6 is a transporter of steroid sulfates associated with spermatogenesis and fertility. It has been shown that SLC10A6 might be a new anti-proliferative breast cancer target as the SLC10A6 inhibition can affect the proliferation of breast cancer cells. SLC10A6 also plays a key role in hepatic inflammation. 27938-1-AP antibody detects the 70 kDa glycosylated form in SDS-PAGE. (PMID: 26510996, 30186172, 28893621)