SLC15A3 Polyclonal antibody

• 

  WB analysis using 20866-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20866-1-AP (SLC15A3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

SLC15A3 Polyclonal Antibody for WB, ELISA

Cat No. 20866-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

hPHT2, OCTP, Osteoclast transporter, Peptide transporter 3, PHT2

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, rat thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

20866-1-AP targets SLC15A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14915

  Product name: Recombinant human SLC15A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 257-379 aa of BC037974

  Sequence: MGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNFFPANPANISVALRAQGSSYTIPEAWLLLAN

• Full Name: solute carrier family 15, member 3
• Calculated Molecular Weight: 581 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC037974
• Gene Symbol: SLC15A3
• Gene ID (NCBI): 51296
• RRID: AB_2935450
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY34
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 15 member 3 (SLC15A3) is a proton-coupled amino-acid transporter, which transports free histidine and certain di- and tripeptides, and is involved in the innate immune response. It can transport carnosine as well (PMID:31073693). SLC15A3 has a calculated molecular weight of 64 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; Glycosaminoglycan-mediated lipoprotein uptake protects cancer cells from ferroptosis; Authors - Dylan Calhoon