SLC15A3 Polyclonal antibody, PBS Only

• 

  WB analysis using 20866-1-AP (same clone as 20866-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20866-1-AP (SLC15A3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20866-1-PBS in a different storage buffer formulation.

SLC15A3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 20866-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

20866-1-PBS targets SLC15A3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14915

  Product name: Recombinant human SLC15A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 257-379 aa of BC037974

  Sequence: MGSQVSSMLKLALQNCCPQLWQRHSARDRQCARVLADERSPQPGASPQEDIANFQVLVKILPVMVTLVPYWMVYFQMQSTYVLQGLHLHIPNFFPANPANISVALRAQGSSYTIPEAWLLLAN

• Full Name: solute carrier family 15, member 3
• Calculated Molecular Weight: 581 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC037974
• Gene Symbol: SLC15A3
• Gene ID (NCBI): 51296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IY34
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Solute carrier family 15 member 3 (SLC15A3) is a proton-coupled amino-acid transporter, which transports free histidine and certain di- and tripeptides, and is involved in the innate immune response. It can transport carnosine as well (PMID:31073693). SLC15A3 has a calculated molecular weight of 64 kDa.