SLC16A13 Polyclonal antibody

• 

  WB analysis using 30466-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30466-1-AP (SLC16A13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 30466-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30466-1-AP (SLC16A13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 30466-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 30466-1-AP (SLC16A13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC16A13 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30466-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MCT 13, MCT13, Monocarboxylate transporter 13, SLC16A13

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30466-1-AP targets SLC16A13 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33183

  Product name: Recombinant human SLC16A13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 395-426 aa of BC142618

  Sequence: FCFSTTTSGPQDLVTEALDTKVPLPKEGLEED

• Full Name: solute carrier family 16, member 13 (monocarboxylic acid transporter 13)
• Calculated Molecular Weight: 426 aa, 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC142618
• Gene Symbol: SLC16A13
• Gene ID (NCBI): 201232
• RRID: AB_3086327
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7RTY0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC16A13 (solute carrier family 16 member 13), which encodes the monocarboxylate transporter 13 (MCT13), is a susceptibility gene for type 2 diabetes and is expressed in the liver and duodenum (PMID: 37630718). SLC16A13 is a potential target for the treatment of type 2 diabetes and non-alcoholic fatty liver disease (PMID: 34211098).