Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30466-1-AP targets SLC16A13 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33183 Product name: Recombinant human SLC16A13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 395-426 aa of BC142618 Sequence: FCFSTTTSGPQDLVTEALDTKVPLPKEGLEED Predict reactive species |
| Full Name | solute carrier family 16, member 13 (monocarboxylic acid transporter 13) |
| Calculated Molecular Weight | 426 aa, 45 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC142618 |
| Gene Symbol | SLC16A13 |
| Gene ID (NCBI) | 201232 |
| RRID | AB_3086327 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7RTY0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC16A13 (solute carrier family 16 member 13), which encodes the monocarboxylate transporter 13 (MCT13), is a susceptibility gene for type 2 diabetes and is expressed in the liver and duodenum (PMID: 37630718). SLC16A13 is a potential target for the treatment of type 2 diabetes and non-alcoholic fatty liver disease (PMID: 34211098).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC16A13 antibody 30466-1-AP | Download protocol |
| WB protocol for SLC16A13 antibody 30466-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





