Tested Applications
Positive WB detected in | mouse brain tissue, human placenta tissue, mouse kidney tissue, mouse skeletal muscle tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
Product Information
20751-1-AP targets NPT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12819 Product name: Recombinant human NPT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC101745 Sequence: MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYST Predict reactive species |
Full Name | solute carrier family 17 (sodium phosphate), member 1 |
Calculated Molecular Weight | 467 aa, 51 kDa |
Observed Molecular Weight | 50 kDa, 60-64 kDa |
GenBank Accession Number | BC101745 |
Gene Symbol | NPT1 |
Gene ID (NCBI) | 6568 |
RRID | AB_10693677 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q14916 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NPT1 (also known as SLC17A1) is a member of sodium-dependent inorganic phosphate transporters (NPT), which regulates entrance into the cellular membrane. NPT1 is mainly expressed in the kidney transporting small organic anions such as PAH (para-aminohippurate), but it is also found in the liver and brain. NTP1 localizes to the apical membrane of renal proximal tubular cells. NPT1 exits two isoforms due to the alternative splicing. Western blot analysis using this antibody detected a major band around 45-55 kDa in kidney tissue.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NPT1 antibody 20751-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Exp Mol Med Impaired Na+-K+-ATPase signaling in renal proximal tubule contributes to hyperuricemia-induced renal tubular injury. | ||
Phytomedicine Eurycomanol alleviates hyperuricemia by promoting uric acid excretion and reducing purine synthesis. | ||
Am J Physiol Renal Physiol Transcriptomics of SGLT2-positive early proximal tubule segments in mice: response to type 1 diabetes, SGLT1/2 inhibition, or GLP1 receptor agonism | ||
Front Pharmacol Effect of Eurycoma longifolia Stem Extract on Uric Acid Excretion in Hyperuricemia Mice. | ||
Int J Biol Macromol Diacylglycerol from camellia oil improves hyperuricemia by inhibiting xanthine oxidase and modulating gut microbiota |