SLC19A3 Polyclonal antibody, PBS Only

• 

  WB analysis using 13407-1-AP (same clone as 13407-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13407-1-AP (SLC19A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13407-1-AP (same clone as 13407-1-PBS)

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 13407-1-AP (SLC19A3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 13407-1-AP (same clone as 13407-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 13407-1-AP (SLC19A3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 13407-1-AP (same clone as 13407-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13407-1-AP (SLC19A3 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 13407-1-AP (same clone as 13407-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13407-1-AP (SLC19A3 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 13407-1-AP (same clone as 13407-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13407-1-AP (SLC19A3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 13407-1-AP (same clone as 13407-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 13407-1-AP (SLC19A3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 13407-1-AP (same clone as 13407-1-PBS)

  IP result of anti-SLC19A3 (IP:13407-1-AP, 4ug; Detection:13407-1-AP 1:600) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 13407-1-PBS in a different storage buffer formulation.

SLC19A3 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 13407-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

13407-1-PBS targets SLC19A3 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4053

  Product name: Recombinant human SLC19A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 188-315 aa of BC032014

  Sequence: LFLPMPKKSMFFHAKPSREIKKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECYSSKRLFYWSLWWAFATAGFNQVLNYVQILWDYKAPSQDSSIY

• Full Name: solute carrier family 19, member 3
• Calculated Molecular Weight: 496 aa, 56 kDa
• Observed Molecular Weight: 63-70 kDa
• GenBank Accession Number: BC032014
• Gene Symbol: SLC19A3
• Gene ID (NCBI): 80704
• RRID: AB_2187997
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZV2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.