Tested Applications
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28343-1-AP targets SLC22A14 in IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28494 Product name: Recombinant human SLC22A14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 92-184 aa of BC075071 Sequence: TAQKPYCNTSWILAVGPHLSKAEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKD Predict reactive species |
| Full Name | solute carrier family 22, member 14 |
| Calculated Molecular Weight | 594 aa, 67 kDa |
| GenBank Accession Number | BC075071 |
| Gene Symbol | SLC22A14 |
| Gene ID (NCBI) | 9389 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y267 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |



