SLC22A7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC22A7 Polyclonal antibody (26796-1-AP)

SLC22A7 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 26796-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

OAT2, NLT, hOAT2

• 

  WB analysis of mouse kidney using 26796-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 26796-1-AP (SLC22A7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 26796-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 26796-1-AP (SLC22A7 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 26796-1-AP

  IP result of anti-SLC22A7 (IP:26796-1-AP, 4ug; Detection:26796-1-AP 1:1000) with mouse liver tissue lysate 5200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 26796-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26796-1-AP (SLC22A7 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 26796-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26796-1-AP (SLC22A7 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 26796-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 26796-1-AP (SLC22A7 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC22A7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26796-1-AP targets SLC22A7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25217

  Product name: Recombinant human SLC22A7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-140 aa of BC033805

  Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ

• Full Name: solute carrier family 22 (organic anion transporter), member 7
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC033805
• Gene Symbol: SLC22A7
• Gene ID (NCBI): 10864
• RRID: AB_2880639
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y694
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Organic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183).

Publications

What published studies show

The SLC22A7 Polyclonal antibody (Cat# 26796-1-AP) has 8 total citations. These appear in journals including Journal of Ethnopharmacology, Biochemical Pharmacology, Food & Function, Nutrients, Drug Metabolism and Disposition, American Journal of Physiology-Renal Physiology, Drug Metabolism and Pharmacokinetics, and Xenobiotica. Associated research fields span urate/organic anion transporter regulation in gout, 5-fluorouracil sensitivity in hepatocellular carcinoma, hepatic fatty acid metabolism, renal pseudouridine excretion in diabetic kidney disease, and drug-transporter expression in arthritis models.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Ethnopharmacol; Huazhuo Sanjie Chubi Decoction attenuates gouty arthritis and kidney fibrosis by regulating urate transporters and JAK2/STAT3 pathway; Authors - Xiaomei Zhong
human	WB	Biochem Pharmacol; Upregulation of histone acetylation reverses organic anion transporter 2 repression and enhances 5-fluorouracil sensitivity in hepatocellular carcinoma.; Authors - Yingying Wang
rat	WB	Food Funct; Multi-strategy profiling identifies limonin's dual role in gout: restoring uric acid homeostasis and suppressing inflammatory response.; Authors - Minjie Zeng
mouse	WB	Nutrients; Effect of Microbial Status on Hepatic Odd-Chain Fatty Acids Is Diet-Dependent.; Authors - Karolin Weitkunat
		Drug Metab Dispos; SND1 Regulates Organic Anion Transporter 2 Protein Expression and Sensitivity of Hepatocellular Carcinoma Cells to 5-Fluorouracil; Authors - Yu Wang
mouse		Am J Physiol Renal Physiol; Tubular Dysfunction Impairs Renal Excretion of Pseudouridine in Diabetic Kidney Disease; Authors - Anna V Mathew