Tested Applications
Positive WB detected in | mouse kidney tissue, rat liver tissue |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | human liver tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
Product Information
26796-1-AP targets SLC22A7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25217 Product name: Recombinant human SLC22A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 42-140 aa of BC033805 Sequence: AAVPAHRCALPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ Predict reactive species |
Full Name | solute carrier family 22 (organic anion transporter), member 7 |
Calculated Molecular Weight | 60 kDa |
Observed Molecular Weight | 60-70 kDa |
GenBank Accession Number | BC033805 |
Gene Symbol | SLC22A7 |
Gene ID (NCBI) | 10864 |
RRID | AB_2880639 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y694 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Organic anion transporter (OAT)2 (SLC22A7) belongs to the solute carrier group of membrane transport proteins that mediate cellular uptake of numerous organic ions including xenobiotics and endogenous substrates (PMID: 9529348, 20190416). SLC22A7 was originally identified as a novel liver-specific transporter because of its predominant mRNA expression in the rat liver (PMID: 15900017, 25904762). Human SLC22A7 exhibits a robust transport function for a wide array of naturally occurring nucleobases, nucleosides, and nucleotides with a particular role for cGMP (PMID: 18216183).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SLC22A7 antibody 26796-1-AP | Download protocol |
IHC protocol for SLC22A7 antibody 26796-1-AP | Download protocol |
IP protocol for SLC22A7 antibody 26796-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biochem Pharmacol Upregulation of histone acetylation reverses organic anion transporter 2 repression and enhances 5-fluorouracil sensitivity in hepatocellular carcinoma. | ||
Drug Metab Pharmacokinet Inhibiting uptake activity of organic anion transporter 2 by bile acids. | ||
Xenobiotica Changes in the expression of drug-metabolising enzymes and drug transporters in mice with collagen antibody-induced arthritis | ||
Am J Physiol Renal Physiol Tubular Dysfunction Impairs Renal Excretion of Pseudouridine in Diabetic Kidney Disease | ||
Drug Metab Dispos SND1 Regulates Organic Anion Transporter 2 Protein Expression and Sensitivity of Hepatocellular Carcinoma Cells to 5-Fluorouracil |