SLC24A2 Polyclonal antibody

• 

  WB analysis using 31289-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31289-1-AP (SLC24A2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SLC24A2 Polyclonal Antibody for WB, ELISA

Cat No. 31289-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

NCKX2, Retinal cone Na Ca+K exchanger, SLC24A2

---

Tested Applications

• Positive WB detected in: ARPE-19 cells, hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31289-1-AP targets SLC24A2 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35294

  Product name: Recombinant human SLC24A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 60-132 aa of NM_020344

  Sequence: SETDTQSTGEASVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDYPKDIFSLEERRK

• Full Name: solute carrier family 24 (sodium/potassium/calcium exchanger), member 2
• Calculated Molecular Weight: 661 aa, 74 kDa
• Observed Molecular Weight: 73-75 kDa
• GenBank Accession Number: NM_020344
• Gene Symbol: SLC24A2
• Gene ID (NCBI): 25769
• RRID: AB_3669931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI40
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.