Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, NCI-H1299 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human lung cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 36 publications below |
| IHC | See 6 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
Product Information
15235-1-AP targets SLC25A1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7352 Product name: Recombinant human SLC25A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-311 aa of BC004980 Sequence: MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAVRFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLLNKVWKTD Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 30-34 kDa |
| GenBank Accession Number | BC004980 |
| Gene Symbol | SLC25A1 |
| Gene ID (NCBI) | 6576 |
| RRID | AB_2254794 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P53007 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC25A1, also known as CIC or CTP, is a mitochondrial citrate transporter that exports citrate from the mitochondria to the cytosol. SLC25A1 is highly expressed in several tumor types. Recently it has been identified as a novel transcriptional target of mutant p53 and a negative tumor prognostic marker. In addition, defects in SLC25A1 has been found as a cause of combined D-2- and L-2-hydroxyglutaric aciduria. This antibody specifically recognized the endogenous SLC25A1; no protein was detected in cells from subjects containing two alleles with truncating mutations with this antibody. (24681808, 23561848)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| IHC protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| IP protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| WB protocol for SLC25A1 antibody 15235-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Circulation Glycolytic Switch Is Required for Transdifferentiation to Endothelial Lineage. | ||
Nat Commun IL-1R-IRAKM-Slc25a1 signaling axis reprograms lipogenesis in adipocytes to promote diet-induced obesity in mice. | ||
Am J Hum Genet Deficiency in SLC25A1, encoding the mitochondrial citrate carrier, causes combined D-2- and L-2-hydroxyglutaric aciduria. | ||
Cell Death Differ Inhibition of the mitochondrial citrate carrier, Slc25a1, reverts steatosis, glucose intolerance, and inflammation in preclinical models of NAFLD/NASH. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Bruna (Verified Customer) (03-05-2022) | This ab works very well for WB in human and mouse cell lines. Very strong and specific band (tested with KO cells lines).
|
FH Chunling (Verified Customer) (12-06-2018) | This antibody works great for western blot and Immunofluorescence. It is very specific with no non specific bands in western.
|























