Product Information
26804-1-PBS targets SLC25A12 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25150 Product name: Recombinant human SLC25A12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC016932 Sequence: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVA Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier, Aralar), member 12 |
| Calculated Molecular Weight | 75 kDa, 63 kDa |
| Observed Molecular Weight | ~70 kDa |
| GenBank Accession Number | BC016932 |
| Gene Symbol | SLC25A12 |
| Gene ID (NCBI) | 8604 |
| RRID | AB_2880641 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75746 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC25A12, also known as ARALAR1, is a key component of the malate-aspartate shuttle, a metabolic system that facilitates the transfer of reducing equivalents (NADH) from the cytoplasm into mitochondria, thereby supporting oxidative phosphorylation and ATP production. SLC25A12 dysfunction results in impaired mitochondrial energy production, which can lead to neuronal damage, developmental delays, and myelination defects (PMID: 20015484).



















