Tested Applications
| Positive WB detected in | mouse heart tissue, mouse kidney tissue, mouse skeletal muscle tissue, rat heart tissue |
| Positive IHC detected in | human breast cancer tissue, human pancreas cancer tissue, human stomach cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26804-1-AP targets SLC25A12 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25150 Product name: Recombinant human SLC25A12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC016932 Sequence: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVA Predict reactive species |
| Full Name | solute carrier family 25 (mitochondrial carrier, Aralar), member 12 |
| Calculated Molecular Weight | 75 kDa, 63 kDa |
| Observed Molecular Weight | ~70 kDa |
| GenBank Accession Number | BC016932 |
| Gene Symbol | SLC25A12 |
| Gene ID (NCBI) | 8604 |
| RRID | AB_2880641 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75746 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC25A12, also known as ARALAR1, is a key component of the malate-aspartate shuttle, a metabolic system that facilitates the transfer of reducing equivalents (NADH) from the cytoplasm into mitochondria, thereby supporting oxidative phosphorylation and ATP production. SLC25A12 dysfunction results in impaired mitochondrial energy production, which can lead to neuronal damage, developmental delays, and myelination defects (PMID: 20015484).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC25A12 antibody 26804-1-AP | Download protocol |
| IHC protocol for SLC25A12 antibody 26804-1-AP | Download protocol |
| WB protocol for SLC25A12 antibody 26804-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC25A12 Polyclonal antibody (Cat# 26804-1-AP) has 3 citations. These appear in Molecular Medicine, Ecotoxicology and Environmental Safety, and Redox Biology. The associated research fields include colorectal cancer and chemotherapy resistance (via MKRN1–AGC1 interaction), sodium arsenite-induced ferroptosis and islet β-cell dysfunction, and pulmonary hypertension driven by malate-aspartate shuttle inactivation with epigenetic remodeling. Applications cited include CoIP and Western blot in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Ecotoxicol Environ Saf SLC25A12-mediated glutamate translocation contributes to NaAsO(2)-induced ferroptosis and islet β-cell dysfunction.
| ||
Redox Biol Malate-aspartate shuttle inactivation drives pulmonary hypertension through glucose carbon flux rewiring and α-ketoglutarate-dependent epigenetic remodeling. |
