SLC25A13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC25A13 Polyclonal antibody, PBS Only (10789-1-PBS)

• 

  IHC staining of human colon cancer using 10789-1-AP (same clone as 10789-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10789-1-AP (SLC25A13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10789-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 10789-1-AP (same clone as 10789-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10789-1-AP (SLC25A13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10789-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10789-1-AP (same clone as 10789-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10789-1-AP (SLC25A13 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10789-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 10789-1-AP (same clone as 10789-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SLC25A13 antibody (10789-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 10789-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 10789-1-AP (same clone as 10789-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using SLC25A13 antibody (10789-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 10789-1-PBS in a different storage buffer formulation.

SLC25A13 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 10789-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

ARALAR2, ARALAR-related gene 2, Calcium-binding mitochondrial carrier protein Aralar2, Citrin, Electrogenic aspartate/glutamate antiporter SLC25A13, mitochondrial

---

Product Information

10789-1-PBS targets SLC25A13 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1242

  Product name: Recombinant human SLC25A13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 336-675 aa of BC006566

  Sequence: SVAGAVGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFMHKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFFGIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTYELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPLFKPSVSTSKAIGGGP

• Full Name: solute carrier family 25, member 13 (citrin)
• Calculated Molecular Weight: 74 kDa
• GenBank Accession Number: BC006566
• Gene Symbol: SLC25A13
• Gene ID (NCBI): 10165
• RRID: AB_2189738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJS0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC25A13, also known as citrin, has been identified as a mitochondrial aspartate-glutamate carrier protein and may be implicated in metabolic compartmentation. It consists of 675 amino acid residues and harbors four EF-hands and six mitochondrial transmembranous (TM) spanners. Mutations in SLC25A13 gene cause adult-onset type II citrullinemia (CTLN2) and neonatal intrahepatic cholestasis (NICCD). The complete deletion or cleaved SLA25A13 proteins have been reported in patients with SLC25A13 mutation.